General Information

  • ID:  hor000578
  • Uniprot ID:  P85797
  • Protein name:  Allatostatin-2b
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LPVYNF
  • Length:  6(69-74)
  • Propeptide:  MRSRTSVLTSSLAFLYFFGIVGRSALAMEETPASSMNLQHYNNMLNPMVFDDTMPEKRAYTYVSEYKRLPVYNFGIGKRWIDTNDNKRGRDYSFGLGKRRQYSFGLGKRNDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEEKRGRQPYSFGLGKRAVHYSGGQPLGSKRPNDMLSQRYHFGLGKRMSEDEEESSQ
  • Signal peptide:  MRSRTSVLTSSLAFLYFFGIVGRSALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85797-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000578_AF2.pdbhor000578_ESM.pdb

Physical Information

Mass: 84124 Formula: C38H53N7O9
Absent amino acids: ACDEGHIKMQRSTW Common amino acids: FLNPVY
pI: 6.09 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 73.33 Boman Index: 516
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 113.33
Instability Index: 3491.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 298

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain